ELF@0@8@``( HPP$$PtdddQtdRtd  GNUDT8MI! y @y{|}~P`^BY۫a z2w=L $ 0 XmF"f7Qm)bsBgQl Z^H6UDO1Z&;J+nzNz, jwudX pz  T} * @9  D__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizefree__stack_chk_guardcallocmallocstrncpystrlencrypt_r__stack_chk_failpipefork__errno_locationwaitpidpam_syslogdup2getrlimitgeteuidsetuidstrdupexecvestdoutfflush_exitsigactionpam_modutil_read__isoc99_sscanfpam_get_itemstrcmpxdr_stringxdr_inttimememsetyp_get_default_domainyp_bindyp_matchyp_unbindfopenfgetsstrncmp__ctype_b_locfclosestrchrstrtolstrcpy__snprintf_chkpam_set_datapam_promptpam_strerrorpam_set_itemis_selinux_enabledfcntlsigfillsetsigemptysetsigaddsetsigprocmaskalarmgetfileconsetfscreateconfreeconpam_modutil_getpwnampam_modutil_getspnammkstempunlinkumaskgetfscreateconfilenofstatfchownfchmodfgetpwentputpwentfsyncrenamememcpygettimeofdaygetpidclock__strncat_chk__strcat_chkpam_modutil_getlogingetuidpam_get_datapam_fail_delay__ctype_tolower_locdcgettextstrstrstrtok_rstrndupfeof__getdelimstrsepstrcasecmpstrncasecmppam_sm_acct_mgmtdcngettextpam_sm_authenticatepam_get_userpam_sm_setcredpam_sm_chauthtokusleepstpcpycrypt__asprintf_chkyp_mastergetrpcportclnt_createauthunix_create_defaultfputsfgetspentputspentpam_modutil_writeclnt_sperrnoyperr_stringpam_sm_open_sessionpam_sm_close_sessionlibpam.so.0libcrypt.so.1libselinux.so.1libnsl.so.2libtirpc.so.3libc.so.6ld-linux-aarch64.so.1pam_extrausers.soXCRYPT_2.0GLIBC_2.17LIBNSL_1.0LIBSELINUX_1.0TIRPC_0.3.0LIBPAM_EXTENSION_1.0LIBPAM_1.0LIBPAM_MODUTIL_1.0GLIBC_2.33      `] b  > `/. J P{ @P) `/hoX @,+@Xpм0HP`x(8@ 8PPhxX`h +:;Zk08@HPX` h p x  ! "(#0$8%@&H'P(X)`*h,p-x./0123456789:<=>?@ABC D(E0F8G@HHIPJXK`LhMpNxOPQRSTUVWXYZ[\]^_`abc d(e0f8g@hHiPjXl`mhnpoxpqrstuvwx {{_{F0    F0 F0 "F1 &F"1 *FB1 .Fb1 2F1 6F1 :F1 >F1 BF2 FF"2 JFB2 NFb2 RF2 VF2 ZF2 ^F2 bF3 fF"3 jFB3 nFb3 rF3 vF3 zF3 ~F3 F4 F"4 FB4 Fb4 F4 F4 F4 F4 F5 F"5 FB5 Fb5 F5 F5 F5 F5 F6 F"6 FB6 Fb6 F6 F6 F6 F6 F7 F"7 FB7 Fb7 F7 F7 F7 F7 G8 G"8  GB8 Gb8 G8 G8 G8 G8 "G9 &G"9 *GB9 .Gb9 2G9 6G9 :G9 >G9 BG: FG": JGB: NGb: RG: VG: ZG: ^G: bG; fG"; jGB; nGb; rG; vG; zG; ~G; G< G"< GB< Gb< G< G< G< G< G= G"= GB= Gb= G= G= G= G= G> G"> GB> Gb> G> G> G> G> G@ _   @!@?T!Ga_@!@!"A !ABGb_ { `B@9@5G@A R`B9 @{¨_     _{Rr (A)cdR @)# J8x@)c c JkRc Yr  J9  Sr9g ݙRB JB J7rB [ -LA)Q. Rc  cJ"Jc t  r/TB)< PŘRB JBJ B r  1\C)* gˆRZ rZJ' Y J &Rƨr f RZ 0rZJRN J hr20D)R ىZ C ZJ D J sR< +rZ ZJT J "8E)( Z Y ZJ Z Jz C$RrrZg  J J 4@F)PE   J VJ; g2Rr {?  J J 6dG)+|  aJJ f qR$ϴr d # JcJc  #R6r# hRP r! J!J' ! R ARþr r<  Z ZJZ <[Rc r c( JZ ZJZ &JR! ˤr !la zJZ ZJZ ER 6r \' :JZ ZJZ R źr H JZ ZJZ cR HrC 0 JZ ZJZ !МR !r! l JZ ZJZ yRc gr c\ JZ ZJZ ƼR! &*bRJ%`r %  kD. 0*J  sEj 6*J s sZ l5*J B BDb L4*J  [B/X 3*J L i  "*J  SAX 8* J  D ,*BJB b cCB, C'*cJc ! {ƨ!hA #%*k cJc  X& "*J cJc  D !* !J) ! () - 4)_ A_!!@94 _8C@95{_ w  {BGS[`c!C@g@ B 99[4AT#9VCX_@@TX6 `T#UH@b"b.IT+Gg@@BTSA[BcC{ͨ_@948@95   {GS*[c@O$5w  6,*g@T4qmT3w@?qT*R*7O@@ T"aRB@*ROc@W4O@!G@"@caTSA[BcC{ܨ_7!R2CR*5/@ᏐH T q`T*k/@sk+T5"B(1T3`)U7Q )L `)B`"B)aR (]G@ RwO?H# R    =8c@cR:R6caR2E$c@.j@q7@@@ cQ? _fB)K@9!!,q#"RB -d@ q T;@!!,"#B.eR!Rm@ @9qT#@9RqT_#@9 R#5_R_#@9qT{!@@q{_{S5RSA{è_u"`5@aB@4ab4ar@4a4a4aq@{SC*!ʹb@|A!M#_DAT` @Ta@b_Td@_T%_$AATR?Ta@R_$ASA@{è_d@?A$DDMT KRSA@{è_֠RSA@{è_c@R"B`/?RSA@{è_ `R!K c,{GS[c*k*@_ R85Z5RG_`@B#T* {@SA[BcCkDc,_ O@5W@5W@!!0s*W@ 5@R?kT[@;c 9&R!|@!= 0!Rcaju8?q!T/5u[[9[@@9@!xbx?sbUT*AR8ARsAR87@ AR8` 8AR&R_8ARs~s@?8;^KZGVCR;@?NGH! B ! !|@@BR?,@@ @94[@?@@9@4&Rk,k@sE>Z4J&RsE7sE5BR@ 7@@9 4[@@95;P&R k@`[E [@@[;[@@[1[@@;@['"R$Є0>@c0k@4@kk@sEs  {GS[*c@ 5  6*q4MTg@*yTc@hg@f8@?qaT*RI*7G@@a TcR!G@"@cҡ TSA[BcC{Ш_ks  R3Rq T`6S@RkDsE3R7@4 57@75RkDsE7@7`6=?qRARkDsE`5@5:5#0`6*5"B`7RjqMT;@ks#  {[S`@c*@BpS~SB+b C4*RBKkT*Qs :<q TQ~Sjzv `@`As,T*SA[BcC{Ĩ*SA[BcC{Ĩ{RS4`!@# CӁBK J#8_qHTRO =` @`*Ob@*```=SA@{è_RRBK{BGS[* C@g7Rf1`T*v~@p@?qA T*kT*hc8RBrT_q@TAQD ?$qTA0QD?dqBDj#8ckT38Gg@@B!TSA[B{ͨ_Rc#`ŸңB#qŽBC 3;9R5*RO-RO&*"dcC*c=c6 {BGS[cks7A@?a@9?qT`@9q%T7@ @9q@z%T"  @8?q$@z`TaT7@w|@8`֟ҸV8q֎V[#{A*bR!!8w@7@**O***qTQ3CQlRsK CqbӘ{CQk!T*15 s~4"RS7s~S5?@$R7@r<`۟[sGc.RWRr\!R HcRDCR@#aR@9A5{GS*[c@?k*4ARs*@4p76kD G?@@B!"T*SA[BcC{Ȩ_9CT47 @! T8tP6kDR!!<Re467@s<!=_{RR@n5`ky8q\zaTc998>:62 H`4$@94 ՟8@95{R sE7@6 4R@XrjaT_#q Hz Tҟk4wa@948@95r@948@95jfTp7!!@<RkDW7#c#aRR=p7!?R<"RBy"aRBRrkD'!!<R#c#aRRlkD@948@95&R!!<RsE"RBF"aRB VR>kDsE!!<Rqks{BGS!=c C@7 d 7b[cC#  5BR+@3 TaR`93@@3"@8@Ӄh`xco7b4!k`8?(qAT?k 83@o53@tA@9c@?q!ahax! @z@TB3A@8?q!ahax! @z!T+@[B#@G7@@BTSAcC{Ǩ_[#L{S[@Rck*s*?5?{@R?s2?rv !26?q26mBR b{qT_z@4_k@58" A) 6*M?@ rT GBR5?@ =qT ;C G մ@bR {{qTzAz*D"B|@_8qT 5SqToq Tgq` T`;A) *"TR@Xrj;@@Tz?@2v 6?@q$@ T 4?@@QlqT?@R }2*SA[BcCkDsE{ɨ_x4{{qaT"aRB 7@Ҁ&BR ? 1(T@qMT2R7@ ;@ҀBR;@ ?@ҀBR?@ 7@ `4 r T?@ÂRzrϒR@r$QkV?kT"aRB G@aR"B RVR2 C@aRz@ q TR"B;@R w{*GS[G@*CAR+@q @ T#*(q` T`5'@*6q T-TRq`Tnq!T"B@Rx!!` <RP7#c#aRv qT7G@@Ba T*SA[B{֨_֓42qAT?@ 5R"B N!!@<RV5?@6 RDSR*"B@ !R9**$qT"B R"!RB $R"B`!! <RTV5R"B ?R"!B!<c?@ "R/W7#c#RR{*GS[҂@/(*t7C*5+@D@9RQjT*4+ 5uG/@@BA T*SA[B@{ƨ_"aRB`SR74u!c!xqRsw4R!! <#*%ҥ`c*4xqT+@"BAR+w4D**'R {cGS4d@Rd@5@*@҆G@@BT*SA@{Ĩ_C Ѥ*RC{CGS3sG@gS)*k*5w@ @9RQj`T[s$p7u*"R!4w@*"R@Pw`z87M@6`{$07R4*M5ckuvu2[CcDkEp7GgA@B!T*{ASBsFC _aRB`\RUw@*X 5v 6S66е<R!+w@!R<7cR@!*ta2ҥ *@85cDs@Rs25w@**PqT;4R[Cw@q!@ `RB \R [CRB w@{@*4qAT*RB`-[CcDkERB! *HqTcks[Cxе<R!+w@!R.7cR@!+a2ҥ *@*5s@s/7w@**4[CcDLB`R;[CcDkEBB#RRl 4w5@!0u5{@!ՐR!r#R"R*y4qxTkp7{@z@B)@@@?@`i!ՐR"R!rc%#U!GB8(@&!R@?*@*|b5@@?q@ ccRB,K @@!@ ?!@!@ ?@|4| %daccount %s has password changed in future/var/lib/extrausers/passwdpasswd.byname_pam_unix_getpwnam_%snulloknonullCannot send password to helper: %mpam_get_item returned error to unix-read-passwordSorry, passwords do not matchunable to obtain a passworderror manipulating passworderror manipulating password data [%s]/var/lib/extrausers/.pwd.lock*NP*/var/lib/extrausers/shadow/var/lib/extrausers/.pwdXXXXXXw/var/lib/extrausers/npasswdpassword changed for %s/dev/urandom$1$$no memory for data-name-UN*X-FAIL-check pass; user (%s) unknowncheck pass; user unknownauthentication failure; logname=%s uid=%d euid=%d tty=%s ruser=%s rhost=%s %s%sno memory for failure recorderBad: new and old password must differ by more than just caseLinux-PAMBad: new and old password are too similarBad: new password is too simpleBad: new password is just a wrapped version of the old oneBad: new password cannot be a palindromeNo password suppliedPassword unchangedCan not get usernameYou must choose a longer password/var/lib/extrausers/opasswdcan't open %s file to check old passwords:,Password has been already used. Choose another.Bad: new password must be different than the old onebad authentication token/etc/login.defs =ENCRYPT_METHODSHA_CRYPT_MAX_ROUNDSoption remember not allowed for this module typeoption minlen not allowed for this module typeoption rounds not allowed for this module typePassword minlen reset to 8 charactersunrecognized option [%s]unrecognized ENCRYPT_METHOD value [%s]could not identify user (from uid=%lu)could not identify user (from getpwnam(%s))account %s has expired (account expired)Your account has expired; please contact your system administratorexpired password for user %s (root enforced)You are required to change your password immediately (root enforced)expired password for user %s (password aged)You are required to change your password immediately (password aged)account %s has expired (failed to change password)password for user %s will expire in %d daysWarning: your password will expire in %d daysWarning: your password will expire in %d daybad username [%s]unix_setcred_returnPassword: -UN*X-PASSauth could not identify password for [%s] or NIS$2a$$5$$6$sha512 notusername [%s] obtainedpassword - could not identify useruser "%s" does not exist in /var/lib/extrausers/passwd%suser "%s" has corrupted passwd entrypassword - out of memorypassword - (old) token not obtainedfailed to set PAM_OLDAUTHTOKYou must wait longer to change your password-UN*X-OLD-PASSuser not authenticatedEnter new UNIX password: Retype new UNIX password: -UN*X-NEW-PASSpassword - new password not obtaineduser password changed by another processuser shadow entry expirednew password not acceptable 2rounds=%u$Algo %s not supported by the crypto backend, falling back to MD5 crypt() failure or out of memory for passwordcan't get local yp domain: %scan't find the master ypserver: %syppasswdd not running on NIS master hostyppasswd daemon running on illegal portUse NIS server on %s with port %dudpNIS password could not be changed.10/sbin/pam_extrausers_updatepam_extrausers_update abnormal exit: %d/var/lib/extrausers/nopasswd:, :%s:%s:%d:%s %s:%s:%d:%s,%s %s:%lu:1:%s /var/lib/extrausers/nshadowxpassword received unknown requestNIS server root password: Changing password for %s.(current) UNIX password: updatepam_extrausers_update waitpid failed: %mpassword%s changed for %s on %snew password not acceptableblowfishsha256open_session - error recovering usernameopen_session - error recovering servicesession opened for user %s by %s(uid=%lu)close_session - error recovering usernameclose_session - error recovering servicesession closed for user %saudituse_first_passtry_first_passnot_set_passuse_authtokshadowmd5debugnodelaynisbigcryptlikeauthremember=noreapbroken_shadowrounds=minlen=obscurenullok_secure./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789./;`+|mxmmJXbx $ o(@   X@ oo0oo,o $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $4404c854f6c4d8cd38bc4d49211f0d8b8fd4d4.debug7.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink $oP( @@ 0((8o,,Eo00T@@^BXX h$$c $ $@n`+`+~tzdhh P 4D