ELF@(@8@``` PP$$Ptd<<<44QtdRtd``` GNU7[rlo Z_:W{\U&-^i5vJ%)3G:zs, }~ @o q d  t 4u  __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizefree__stack_chk_guardcallocmallocstrncpystrlencrypt_r__stack_chk_failpipeforkdup2pam_modutil_sanitize_helper_fdsgeteuidsetuidexecvepam_syslogstdoutfflush_exit__errno_locationwaitpidsigactionpam_modutil_read__isoc99_sscanfpam_get_itemstrcmpxdr_stringxdr_inttimegetuidpam_modutil_search_keystrncasecmpstrtolstrncmpmemsetyp_get_default_domainyp_bindyp_matchyp_unbindfopenfgets__ctype_b_locfclosestrchrstrcpy__snprintf_chkpam_set_datapam_modutil_getpwnampam_modutil_getspnamis_selinux_enabledstrdupmkstempunlinkumaskgetfilecongetfscreateconsetfscreateconfreeconfilenofstatfchownfchmodfgetpwentputpwentfsyncrenamememcpygettimeofdaygetpidclock__strncat_chk__strcat_chkdcgettextstrtok_rpam_promptpam_modutil_getloginpam_get_datapam_fail_delaycrypt_checksaltpam_sm_acct_mgmtdcngettextpam_sm_authenticatepam_get_userpam_get_authtokpam_sm_setcredpam_sm_chauthtokusleepcrypt_gensalt_rnulckpwdfpam_set_itemendnetconfigclnt_createauthunix_create_defaultfputsyp_mastersetnetconfiggetnetconfigfgetspentputspentpam_modutil_writerpcb_getaddr__rpc_createerrclnt_pcreateerroryperr_string__rpc_nconf2sockinfoclnt_sperrnopam_sm_open_sessionpam_sm_close_sessionlibpam.so.0libcrypt.so.1libselinux.so.1libnsl.so.2libtirpc.so.3libc.so.6ld-linux-aarch64.so.1pam_unix.soGLIBC_2.17LIBNSL_1.0LIBSELINUX_1.0XCRYPT_2.0XCRYPT_4.3LIBPAM_EXTENSION_1.1LIBPAM_MODUTIL_1.3.2LIBPAM_EXTENSION_1.0LIBPAM_1.0LIBPAM_MODUTIL_1.0LIBPAM_MODUTIL_1.1.9GLIBC_2.33TIRPC_0.3.0              ^ `/ N @0`] c]4pQ) o P) `/ho)o <x0QjP{ \`0,h+е0Ȣжآ0Ppз 0@0HPppX`и`hp0PHpйȿпؿ)9:XhX`hpx     ȼмؼ (08 @!H"P#X$`%h&p'x(*+,-./012Ƚ3н4ؽ56789;<=> ?(@0A8B@CHDPEXF`GhHpIxJKLMNOPQRSȾTоUؾVWXYZ[\]^ _(`0a8b@cHdPeXf`ghipjxklmnopqrs {{_{*FB1    .Fb1 2F1 6F1 :F1 >F1 BF2 FF"2 JFB2 NFb2 RF2 VF2 ZF2 ^F2 bF3 fF"3 jFB3 nFb3 rF3 vF3 zF3 ~F3 F4 F"4 FB4 Fb4 F4 F4 F4 F4 F5 F"5 FB5 Fb5 F5 F5 F5 F5 F6 F"6 FB6 Fb6 F6 F6 F6 F6 F7 F"7 FB7 Fb7 F7 F7 F7 F7 G8 G"8  GB8 Gb8 G8 G8 G8 G8 "G9 &G"9 *GB9 .Gb9 2G9 6G9 :G9 >G9 BG: FG": JGB: NGb: RG: VG: ZG: ^G: bG; fG"; jGB; nGb; rG; vG; zG; ~G; G< G"< GB< Gb< G< G< G< G< G= G"= GB= Gb= G= G= G= G= G> G"> GB> Gb> G> G> G> G> G@_   @!@?T!Ga_@!@!"A !ABGb_ { `B@9@5G@a R`B9 @{¨_     {Rr (A)cdR @)# J8x@)c c JkRc Yr  J9  Sr9g ݙRB JB J7rB [ -LA)Q. Rc  cJ"Jc t  r/TB)< PŘRB JBJ B r  1\C)* gˆRZ rZJ' Y J &Rƨr f RZ 0rZJRN J hr20D)R ىZ C ZJ D J sR< +rZ ZJT J "8E)( Z Y ZJ Z Jz C$RrrZg  J J 4@F)PE   J VJ; g2Rr {?  J J 6dG)+|  aJJ f qR$ϴr d # JcJc  #R6r# hRP r! J!J' ! R ARþr r<  Z ZJZ <[Rc r c( JZ ZJZ &JR! ˤr !la zJZ ZJZ ER 6r \' :JZ ZJZ R źr H JZ ZJZ cR HrC 0 JZ ZJZ !МR !r! l JZ ZJZ yRc gr c\ JZ ZJZ ƼR! &*bRJ%`r %  kD. 0*J  sEj 6*J s sZ l5*J B BDb L4*J  [B/X 3*J L i  "*J  SAX 8* J  D ,*BJB b cCB, C'*cJc ! {ƨ!hA #%*k cJc  X& "*J cJc  D !* !J) ! () - 4)_  A_  {BGS[`c!C@g2@ B 994AT#9CX_@@Tt6 `T#Ud@b"b.ITCGg@@BTSA[BcC{ͨ_@948@95-<!3 {GS[c@OCP`5wl3 6X*W@5c/!Ro*qT*R7"51 T #c /xB` "B`aR G@ Rq T3\@?qa T*Ri*7O@@T"aRBROS@7O@!G@"@c! TSA[BcC{ۨ_OC?H R    =jS@cZ4J&RsE7sE5BR@ 7@@9 4[@@95;T&R k#@`[I [@@[?[@@[5[@@;@[+"R$F@c0k@4@kk@sEs  {GS[c@C 5wl 6 *q4-TW@@RkBЃ*B|@y TW@!"!%r@ TS@3aW@_%@?qA T*R2*7O@@! Tc5R9Rww@4:R` 4AqT`?qRARkDsE;@7@R!G@"@cҡ TSA[BcC{Ш_ksR3Rq T`@RkDsE3R7@ 57@75RkDsE7@7`?qRARkDsE\k`5d@5:5`#*5"BRqMT;@mkks  {[S`@c*@BpS~SB+b C4*RBKkT*Qs q TQ~Sjzv `@`AsT*SA[BcC{Ĩ*SA[BcC{Ĩ{RS4`!@# CӁBK J#8_qHTROq =` @`*Ohb@*```=SA@{è_RRBK{BGS[* C@g`R1`T*v~@@?qA T*kT*hc8RBrT_q@TAQD ?$qTA0QD?dqBDj#8ckTП38Gg@@B!TSA[B{ͨ_Rc#`ŸңB#qŽBC 3;R5*RO-$RO&*"dcC*cc {BGS[7A@g?!cks`@9q%T7@ @9q@z &T"  @8?q$@z`TaT7@w|@8`֟ҸV8q֎V[#{*bR!!w@7@**O***qTQ3CQlRsK CqbӘ{CQk!T*15 s~4"RS7s~S5?@$R7@r<`۟`[lRB >RkE[c{*GSG@7=AR#@a!@9?q@zT!R@!!@9?q@zT[!%5RT6[BaRBsR!G7@"@cTSA{Ǩ_ARBcR#@N@#҄"R#@f*RBIR[B@#@'p@r[{*GSG@'ARG#@!@9?q@zT!R=@!@9?q@zTR7#@RB BaRRG'@@BҡT*SA@{Ũ_ARB@ R {{_Could not make pipe: %mstdoutdup2 of %s failed: %msetuid failed: %m-1/sbin/unix_chkpwdchkexpiryhelper binary execve failed: %munix_chkpwd abnormal exit: %d%dread unix_chkpwd output error %d: %mFork failed: %munix_chkpwd waitpid returned %d: %m user=**unknown**%d more authentication failure%s; logname=%s uid=%d euid=%d tty=%s ruser=%s rhost=%s %s%sservice(%s) ignoring max retries; %d > %daccount %s has password changed in futureENCRYPT_METHOD/etc/login.defsSHA_CRYPT_MAX_ROUNDSoption remember not allowed for this module typeoption minlen not allowed for this module typeoption rounds not allowed for this module typePassword minlen reset to 8 charactersunrecognized option [%s]unrecognized ENCRYPT_METHOD value [%s]r/etc/passwdpasswd.byname_pam_unix_getpwnam_%snulloknonullstdinCannot send password to helper: %m*NP*could not identify user (from getpwnam(%s))user [%s] has expired blank password, enabling nullok/etc/shadow/etc/.pwdXXXXXXw/etc/npasswdpassword changed for %s/dev/urandom$1$$No password has been supplied.Linux-PAMThe password has not been changed.Can not get usernameYou must choose a shorter password.You must choose a longer password./etc/security/opasswdcan't open %s file to check old passwords:,Password has been already used. Choose another.bad authentication tokenno memory for data-name-UN*X-FAIL-check pass; user (%s) unknowncheck pass; user unknownThe support for password hash "%.6s" has been disabled in libcrypt configuration.The password hash "%.6s" is unknown to libcrypt.authentication failure; logname=%s uid=%d euid=%d tty=%s ruser=%s rhost=%s %s%sno memory for failure recordercould not identify user (from uid=%lu)unix_setcred_returnaccount %s has expired (account expired)Your account has expired; please contact your system administrator.expired password for user %s (root enforced)You are required to change your password immediately (administrator enforced).expired password for user %s (password aged)You are required to change your password immediately (password expired).account %s has expired (failed to change password)password for user %s will expire in %d daysWarning: your password will expire in %d days.Warning: your password will expire in %d day.pam_unix_auth: cannot allocate ret_databad username [%s]username [%s] obtainedcould not obtain usernameuser [%s] has blank password; authenticated without itauth could not identify password for [%s] or NIS$6$$gy$$2b$$5$sha51210 notpassword - could not identify useruser "%s" does not exist in /etc/passwd%suser "%s" has corrupted passwd entryChanging password for %s.password - (old) token not obtainedYou must wait longer to change your password.user not authenticatedpassword - new password not obtaineduser password changed by another processuser shadow entry expirednew password not acceptable 2Algo %s not supported by the crypto backend. crypt() failure or out of memory for passwordcan't get local yp domain: %scan't find the master ypserver: %sudprpcb_getaddr (%s) failed!Cannot find suitable transport for protocol 'udp'yppasswdd not running on NIS master hostyppasswd daemon running on illegal portUse NIS server on %s with port %dNIS password could not be changed./sbin/unix_updateupdateunix_update abnormal exit: %d/etc/security/nopasswd:, :%s:%s:%d:%s %s:%s:%d:%s,%s %s:%lu:1:%s /etc/nshadowxpassword received unknown requestunix_update waitpid failed: %mpassword%s changed for %s on %syescryptnew password not acceptablegost_yescrypt$y$blowfishsha256open_session - error recovering usernameopen_session - error recovering servicegetpwnam error%usession opened for user %s(uid=%s) by %s(uid=%lu)close_session - error recovering usernameclose_session - error recovering servicesession closed for user %saudituse_first_passtry_first_passauthtok_type=use_authtokshadowmd5debugnodelaynisbigcryptlikeauthremember=noreapbroken_shadowrounds=minlen=quietno_pass_expirydesnullresetokobscurenullok_secure./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789./;0%4Hd\pPxH\4$TԨ 4`԰`ԹHHt DL t x8 (| zRx 0,< @,HA BNdX@|P A` HDK Kz4ADEL A 4 A65D43B21C0/a A 0XhAB Cn A J A @tUG0A0CG A AG A ^H0\A0CCj A O A D A J A @,@ABC C B A xpBBCCBDY A _RFB A A A N B BA4A65D43B21C0/w A H$A@BCBS A E A N A (p,AP DB_ A <(A` D BC[ A O A $ХA0D\ A (XAP DBT A 00<AP FR A NGGGBd(A EBZAJAQ A AAN AA J AA K AA WCBAA@A@BBCt A E A (0A0DD` A @\ADIr A ClC B AtHA*)D('B&%J#$A!"A AAKA('&%$#"! *)gA#$A!"A AD B F QMAKA JAB JQEAA HR IAA MF S A KAAB AA@ܵA@BBCs A E A (A0DD` A tD8P ABvuCtsBrqBpoGnmD A UklQlkA]klyIlk A ]dlkCSkl,A*)G('&%{ A ,AP GM A $A0EU A D|AF`_E^]VUW[\`YZ~WXbdAA\[MM A G\[VA\[ZYMAA\[hI\[IA\[ZYIAA\[AA\[ZYI AA GAA\[F A H A B A OZYIG A QA\[ZYXWs_WXu A HB AA wXWCSWXUSXWIFWX\BXWM B L A _BWXI A F A L A G A I A HUWX_LXWcHXWvA[\AYZAWXAFXWkIXWNIXWN A TSXW_ A _GWXL A l A O A @ 8Ap K Z IP A G Z A HA (L AP Gw A 0,+ Ȣ@آ= @= 0@H p=@=X`=`hp=H= =@4@N^jx @$ `ho @ h @8 ` ooooo `$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$ebad10035b7f72849d3c55f2977fecc1ba3541.debug;B&.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink $oP( @@p 0 h8oEoPT``^B8 h@$@$c`$`$nP+P+4ftz<<4ppx ``hhppP@@   4@